Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDSN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CDSN (NP_001255.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDSN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CDSN (NP_001255.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10194A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDSN |
| Target Synonyms | PSS; HTSS; PSS1; HTSS1; HYPT2; CDSN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, A-431, BxPC-3, Mouse skeletal muscle, Mouse skin, Rat skeletal muscle, Rat skin | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CDSN (NP_001255.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGSAGSFKPGTGYSQVSYSSGSGSSLQGASGSSQLGSSSSHSGSSGSHSGSSSSHSSSSSSFQFSSSSFQVGNGSALPTNDNSYRGILNPSQPGQSSSSSQ | Uniprot ID | Q15517 |
Uniprot Id
Q15517
Target Species
Human
Target Name
CDSN
Target Full Name
Corneodesmosin
Target Function
Important for the epidermal barrier integrity.
Target Involvement
Hypotrichosis 2 (HYPT2); Peeling skin syndrome 1 (PSS1)
Target Subcellular Location
Secreted. Note=Found in corneodesmosomes, the intercellular structures that are involved in desquamation.
Target Tissue Specificity
Exclusively expressed in skin.
Target Synonyms
AI747712; CDSN; CDSN_HUMAN; Corneodesmosin; D6S586E; DADB-141O4.5; Differentiated keratinocyte S protein; HTSS; S; S protein
Target Background
This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. The encoded protein undergoes a series of cleavages during corneocyte maturation. This gene is highly polymorphic in human populations, and variation has been associated with skin diseases such as psoriasis, hypotrichosis and peeling skin syndrome. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
