-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human CDT1 (NP_112190.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human CDT1 (NP_112190.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08723A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDT1 |
| Target Synonyms | DUP; RIS2; CDT1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human CDT1 (NP_112190.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLPELARVLRSVFVSERKPALSMEVACARMVGSCCTIMSPGEMEKHLLLLSELLPDWLSLHRIRTDTYVKLDKAADLAHITARLAHQTRAEEGL | Uniprot ID | Q9H211 |
Uniprot Id
Q9H211
Target Species
Human
Target Name
CDT1
Target Full Name
DNA replication factor Cdt1
Target Function
Required for both DNA replication and mitosis. DNA replication licensing factor, required for pre-replication complex assembly. Cooperates with CDC6 and the origin recognition complex (ORC) during G1 phase of the cell cycle to promote the loading of the mini-chromosome maintenance (MCM) complex onto DNA to generate pre-replication complexes (pre-RC)(PubMed:14672932). Required also for mitosis by promoting stable kinetochore-microtubule attachments. Potential oncogene.
Target Involvement
Meier-Gorlin syndrome 4 (MGORS4)
Target Subcellular Location
Nucleus. Chromosome, centromere, kinetochore.
Target Protein Families
Cdt1 family
Target Synonyms
CDT 1; cdt1; CDT1_HUMAN; Chromatin licensing and DNA replication factor 1; DNA replication factor; DNA replication factor Cdt1; Double parked; Double parked Drosophila homolog of; Double parked homolog; DUP; Retroviral integration site 1; Retroviral integration site 2; Retroviral integration site1; Retroviral integration site2; RIS 2; RIS2
Target Background
The protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for DNA replication. The encoded protein can bind geminin, which prevents replication and may function to prevent this protein from initiating replication at inappropriate origins. Phosphorylation of this protein by cyclin A-dependent kinases results in degradation of the protein.
Notification