-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDX2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDX2 (Q99626 ) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDX2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDX2 (Q99626 ) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14217A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDX2 |
| Target Synonyms | CDX3; CDX-3; CDX2/AS; X2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse colon, SW620 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDX2 (Q99626 ). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGS | Uniprot ID | Q99626 |
Uniprot Id
Q99626
Target Species
Human
Target Name
CDX2
Target Full Name
Homeobox protein CDX-2
Target Function
Transcription factor which regulates the transcription of multiple genes expressed in the intestinal epithelium. Binds to the promoter of the intestinal sucrase-isomaltase SI and activates SI transcription. Binds to the DNA sequence 5'-ATAAAAACTTAT-3' in the promoter region of VDR and activates VDR transcription. Binds to and activates transcription of LPH. Activates transcription of CLDN2 and intestinal mucin MUC2. Binds to the 5'-AATTTTTTACAACACCT-3' DNA sequence in the promoter region of CA1 and activates CA1 transcription. Important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine. Binds preferentially to methylated DNA.
Target Subcellular Location
Nucleus.
Target Protein Families
Caudal homeobox family
Target Tissue Specificity
Detected in small intestine, colon and pancreas.
Target Synonyms
Caudal type homeo box 2; Caudal type homeo box transcription factor 2; Caudal type homeobox 2; Caudal type homeobox protein 2; Caudal type homeobox transcription factor 2; Caudal-type homeobox protein 2; CDX 2; CDX 3; CDX-3; Cdx2; CDX2/AS; CDX2_HUMAN; CDX3; Homeobox protein CDX 2; Homeobox protein CDX-2
Target Background
This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis.
Notification