-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CEBPA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 111-180 of human CEBPA (NP_004355.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CEBPA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 111-180 of human CEBPA (NP_004355.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12775A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CEBPA |
| Target Synonyms | CEBP; C/EBP-alpha; CEBPA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, LO2, Rat kidney, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 111-180 of human CEBPA (NP_004355.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP | Uniprot ID | P49715 |
Uniprot Id
P49715
Target Species
Human
Target Name
CEBPA
Target Full Name
CCAAT/enhancer-binding protein alpha
Target Function
Transcription factor that coordinates proliferation arrest and the differentiation of myeloid progenitors, adipocytes, hepatocytes, and cells of the lung and the placenta. Binds directly to the consensus DNA sequence 5'-TCan act as dominant-negative. Binds DNA and have transctivation activity, even if much less efficiently than isoform 2. Does not inhibit cell proliferation.; Directly and specifically enhances ribosomal DNA transcription interacting with RNA polymerase I-specific cofactors and inducing histone acetylation.
Target Involvement
Leukemia, acute myelogenous (AML)
Target Subcellular Location
Nucleus.; [Isoform 4]: Nucleus, nucleolus.
Target Protein Families
BZIP family, C/EBP subfamily
Target Synonyms
Apoptotic cysteine protease; Apoptotic protease Mch 5; C/EBP alpha; C/ebpalpha; CAP4; Caspase 8 precursor; CBF-A; CCAAT Enhancer Binding Protein alpha; CCAAT/enhancer binding protein (C/EBP); alpha; CCAAT/enhancer-binding protein alpha; CEBP ; CEBP A; CEBP alpha; Cebpa; CEBPA_HUMAN; FADD homologous ICE/CED 3 like protease; FADD like ICE; FLICE; ICE like apoptotic protease 5; ICE8; MACH; MCH5; MORT1 associated CED 3 homolog
Target Background
This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain and recognizes the CCAAT motif in the promoters of target genes. The encoded protein functions in homodimers and also heterodimers with CCAAT/enhancer-binding proteins beta and gamma. Activity of this protein can modulate the expression of genes involved in cell cycle regulation as well as in body weight homeostasis. Mutation of this gene is associated with acute myeloid leukemia. The use of alternative in-frame non-AUG (GUG) and AUG start codons results in protein isoforms with different lengths. Differential translation initiation is mediated by an out-of-frame, upstream open reading frame which is located between the GUG and the first AUG start codons.
Notification