-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cenexin1 / ODF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 730-829 of human Cenexin1 / ODF2 (Q5BJF6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cenexin1 / ODF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 730-829 of human Cenexin1 / ODF2 (Q5BJF6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13241A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cenexin1 / ODF2 |
| Target Synonyms | CT134; ODF84; ODF2/1; ODF2/2; Cenexin1 / ODF2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, PC-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 730-829 of human Cenexin1 / ODF2 (Q5BJF6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPPA | Uniprot ID | Q5BJF6 |
Uniprot Id
Q5BJF6
Target Species
Human
Target Name
ODF2
Target Full Name
Outer dense fiber protein 2
Target Function
Seems to be a major component of sperm tail outer dense fibers (ODF). ODFs are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail. May have a modulating influence on sperm motility. Functions as a general scaffold protein that is specifically localized at the distal/subdistal appendages of mother centrioles. Component of the centrosome matrix required for the localization of PLK1 and NIN to the centrosomes. Required for the formation and/or maintenance of normal CETN1 assembly.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cell projection, cilium. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cytoplasm, cytoskeleton, spindle pole. Cell projection, cilium, flagellum.
Target Protein Families
ODF2 family
Target Tissue Specificity
Testis-specific (at protein level). Highly expressed in cytoplasm of step 2 round spermatids. Detected in the middle piece and extends to about half the principal piece of the sperm tails.
Target Synonyms
84 kDa outer dense fiber protein; Cancer/testis antigen 134; Cenexin 1; Cenexin; Cenexin1 variant 1; CT134; FLJ44866; KKT 4; KKT4; MGC111096; MGC9034; ODF 2; ODF 84; odf2; ODF2/1; ODF2/2; ODF84; ODFP2_HUMAN; OTTHUMP00000022274; OTTHUMP00000022275; Outer dense fiber of sperm tail 2; Outer dense fiber of sperm tails 2; Outer dense fiber of sperm tails protein 2; Outer dense fiber of sperm tails; 84 kD; Outer dense fiber protein 2; Sperm outer dense fiber major protein 2; Sperm tail structural protein; Testis specific autoantigen
Target Background
The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. This gene encodes one of the major outer dense fiber proteins. Alternative splicing results in multiple transcript variants. The longer transcripts, also known as 'Cenexins', encode proteins with a C-terminal extension that are differentially targeted to somatic centrioles and thought to be crucial for the formation of microtubule organizing centers.
Notification