-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CENPA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CENPA (NP_001800.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CENPA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CENPA (NP_001800.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12167A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CENPA |
| Target Synonyms | CenH3; CENP-A; CENPA | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HCT116, HepG2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CENPA (NP_001800.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEA | Uniprot ID | P49450 |
Uniprot Id
P49450
Target Species
Human
Target Name
CENPA
Target Full Name
Histone H3-like centromeric protein A
Target Function
Histone H3-like nucleosomal protein that is specifically found in centromeric nucleosomes. Replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. The presence of CENPA subtly modifies the nucleosome structure and the way DNA is wrapped around the nucleosome and gives rise to protruding DNA ends that are less well-ordered and rigid compared to nucleosomes containing histone H3. May serve as an epigenetic mark that propagates centromere identity through replication and cell division. Required for recruitment and assembly of kinetochore proteins, and as a consequence required for progress through mitosis, chromosome segregation and cytokinesis.
Target Subcellular Location
Nucleus. Chromosome, centromere, kinetochore. Chromosome, centromere.
Target Protein Families
Histone H3 family
Target Synonyms
CENP A; CENP-A; cenpa; CENPA_HUMAN; Centromere autoantigen A; Centromere protein A 17kDa ; Centromere protein A; Histone H3 like centromeric protein A; Histone H3-like centromeric protein A
Target Background
Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification