-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CENPF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1730-1890 of human CENPF (NP_057427.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CENPF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1730-1890 of human CENPF (NP_057427.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10578A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CENPF |
| Target Synonyms | CENF; hcp-1; CILD31; STROMS; PRO1779; CENPF | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1730-1890 of human CENPF (NP_057427.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NYEPPGEDKTQGSSECISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESLLNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQELLQRVETSEGLNSDLEMHADKSSREDIGDNVAKVN | Uniprot ID | P49454 |
Uniprot Id
P49454
Target Species
Human
Target Name
CENPF
Target Full Name
Centromere protein F
Target Function
Required for kinetochore function and chromosome segregation in mitosis. Required for kinetochore localization of dynein, LIS1, NDE1 and NDEL1. Regulates recycling of the plasma membrane by acting as a link between recycling vesicles and the microtubule network though its association with STX4 and SNAP25. Acts as a potential inhibitor of pocket protein-mediated cellular processes during development by regulating the activity of RB proteins during cell division and proliferation. May play a regulatory or permissive role in the normal embryonic cardiomyocyte cell cycle and in promoting continued mitosis in transformed, abnormally dividing neonatal cardiomyocytes. Interaction with RB directs embryonic stem cells toward a cardiac lineage. Involved in the regulation of DNA synthesis and hence cell cycle progression, via its C-terminus. Has a potential role regulating skeletal myogenesis and in cell differentiation in embryogenesis. Involved in dendritic cell regulation of T-cell immunity against chlamydia.
Target Involvement
Stromme syndrome (STROMS)
Target Subcellular Location
Cytoplasm, perinuclear region. Nucleus matrix. Chromosome, centromere, kinetochore. Cytoplasm, cytoskeleton, spindle. Note=Relocalizes to the kinetochore/centromere (coronal surface of the outer plate) and the spindle during mitosis. Observed in nucleus during interphase but not in the nucleolus. At metaphase becomes localized to areas including kinetochore and mitotic apparatus as well as cytoplasm. By telophase, is concentrated within the intracellular bridge at either side of the mid-body.
Target Protein Families
Centromere protein F family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
AH antigen; Cell cycle dependent 350K nuclear protein; CENF; CENP F; CENP F kinetochore protein; CENP-F; CENPF; CENPF kinetochore protein; CENPF_HUMAN; Centromere protein F 350/400ka; Centromere protein F; Centromere protein F, 350/400kDa; CILD31; Hcp 1; Hcp1; Kinetochore protein CENP F; Kinetochore protein CENPF; Mitosin; PRO1779; STROMS
Target Background
This gene encodes a protein that associates with the centromere-kinetochore complex. The protein is a component of the nuclear matrix during the G2 phase of interphase. In late G2 the protein associates with the kinetochore and maintains this association through early anaphase. It localizes to the spindle midzone and the intracellular bridge in late anaphase and telophase, respectively, and is thought to be subsequently degraded. The localization of this protein suggests that it may play a role in chromosome segregation during mitotis. It is thought to form either a homodimer or heterodimer. Autoantibodies against this protein have been found in patients with cancer or graft versus host disease.
Notification