Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CERCAM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 466-595 of human CERCAM (NP_057258.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CERCAM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 466-595 of human CERCAM (NP_057258.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05693A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CERCAM |
| Target Synonyms | CEECAM1; GLT25D3; CERCAM | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 466-595 of human CERCAM (NP_057258.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VVAGYSYWTLAYALRLAGARKLLASQPLRRMLPVDEFLPIMFDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYAGDAEWLSDTETSSPWDDDSGRLISWSGSQKTLRSPRLDLTGSSGHSLQPQPRDEL | Uniprot ID | Q5T4B2 |
Uniprot Id
Q5T4B2
Target Species
Human
Target Name
CERCAM
Target Full Name
Inactive glycosyltransferase 25 family member 3
Target Function
Probable cell adhesion protein involved in leukocyte transmigration across the blood-brain barrier. Does not express any beta-galactosyltransferase activity in vitro.
Target Subcellular Location
Endoplasmic reticulum lumen.
Target Protein Families
Glycosyltransferase 25 family
Target Tissue Specificity
Ubiquitous. Highly expressed in secretory and nervous tissues.
Target Synonyms
CEECAM1 ; Cercam; Cerebral cell adhesion molecule; Cerebral endothelial cell adhesion molecule 1; Cerebral endothelial cell adhesion molecule; GLT25D3 ; Glycosyltransferase 25 domain containing 3; Glycosyltransferase 25 family member 3; Glycosyltransferase 25 family member 3 precursor ; GT253_HUMAN; Probable inactive glycosyltransferase 25 family member 3
Target Background
Enables identical protein binding activity. Acts upstream of or within cell adhesion. Predicted to be located in endoplasmic reticulum lumen.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
