Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CERK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human CERK (NP_073603.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CERK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human CERK (NP_073603.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04763A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CERK |
| Target Synonyms | LK4; hCERK; dA59H18.2; dA59H18.3; CERK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, LO2, Mouse testis, Rat thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human CERK (NP_073603.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CRRSPRGLSPAAHLGDGSSDLILIRKCSRFNFLRFLIRHTNQQDQFDFTFVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS | Uniprot ID | Q8TCT0 |
Uniprot Id
Q8TCT0
Target Species
Human
Target Name
CERK
Target Full Name
Ceramide kinase
Target Function
Catalyzes specifically the phosphorylation of ceramide to form ceramide 1-phosphate. Acts efficiently on natural and analog ceramides (C6, C8, C16 ceramides, and C8-dihydroceramide), to a lesser extent on C2-ceramide and C6-dihydroceramide, but not on other lipids, such as various sphingosines. Shows a greater preference for D-erythro isomer of ceramides. Binds phosphoinositides.
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein.
Target Tissue Specificity
High level expression in heart, brain, skeletal muscle, kidney and liver; moderate in peripheral blood leukocytes and thymus; very low in spleen, small intestine, placenta and lung.
Target Synonyms
Acylsphingosine kinase; Ceramide kinase; Cerk; CERK1_HUMAN; dA59H18.2; dA59H18.3; hCERK; KIAA1646; Lipid kinase 4; Lipid kinase LK4; LK4
Target Background
CERK converts ceramide to ceramide 1-phosphate (C1P), a sphingolipid metabolite. Both CERK and C1P have been implicated in various cellular processes, including proliferation, apoptosis, phagocytosis, and inflammation (Kim et al., 2006 [PubMed 16488390]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
