-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CETN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human CETN3 (NP_004356.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CETN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human CETN3 (NP_004356.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09144A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CETN3 |
| Target Synonyms | CEN3; CDC31; CETN3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, MCF7, Mouse lung, Mouse ovary, Mouse spleen, Mouse testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human CETN3 (NP_004356.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI | Uniprot ID | O15182 |
Uniprot Id
O15182
Target Species
Human
Target Name
CETN3
Target Full Name
Centrin-3
Target Function
Plays a fundamental role in microtubule-organizing center structure and function.; As a component of the TREX-2 complex, involved in the export of mRNAs to the cytoplasm through the nuclear pores.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus, nucleolus. Nucleus envelope. Nucleus, nuclear pore complex. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole.
Target Protein Families
Centrin family
Target Research Area
Tags & Cell Markers
Target Synonyms
CDC31 homolog; CEN 3; CEN3; Centrin EF hand protein 3; Centrin-3; Centrin3; CETN 3; Cetn3; CETN3_HUMAN; EF hand superfamily member; MGC12502; MGC138245
Target Background
The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification