Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CFAP61 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CFAP61 (NP_056400.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CFAP61 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CFAP61 (NP_056400.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08873A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CFAP61 |
| Target Synonyms | CaM-IP3; C20orf26; dJ1002M8.3; dJ1178H5.4; CFAP61 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CFAP61 (NP_056400.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSVLTSPRGKVEVVHCRRTESQDVYCIKSLIRKFTCKLFGKLNIIYLLEKANLAVTLCNDKEEIMAQATFLDYPNWNVAKQDDWVSVFRELDSDIPCTPL | Uniprot ID | Q8NHU2 |
Uniprot Id
Q8NHU2
Target Species
Human
Target Name
CFAP61
Target Full Name
Cilia- and flagella-associated protein 61
Target Function
May regulate cilium motility through its role in the assembly of the axonemal radial spokes.
Target Subcellular Location
Cytoplasm, cytoskeleton, cilium axoneme.
Target Synonyms
C20orf26; CT026_HUMAN; dJ1002M8.3; dJ1178H5.4; RP11-470C13.3; Uncharacterized protein C20orf26
Target Background
Predicted to be involved in cilium movement and cilium organization. Predicted to be located in axoneme and motile cilium. Predicted to colocalize with radial spoke stalk.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
