-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CFL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CFL1 (NP_005498.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CFL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CFL1 (NP_005498.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12159A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CFL1 |
| Target Synonyms | CFL; cofilin; HEL-S-15; CFL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, 293T, A-549, Jurkat, Mouse brain, Mouse liver, Rat ovary | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CFL1 (NP_005498.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLV | Uniprot ID | P23528 |
Uniprot Id
P23528
Target Species
Human
Target Name
CFL1
Target Full Name
Cofilin-1
Target Function
Binds to F-actin and exhibits pH-sensitive F-actin depolymerizing activity. In conjunction with the subcortical maternal complex (SCMC), plays an essential role for zygotes to progress beyond the first embryonic cell divisions via regulation of actin dynamics. Required for the centralization of the mitotic spindle and symmetric division of zygotes. Plays a role in the regulation of cell morphology and cytoskeletal organization in epithelial cells. Required for the up-regulation of atypical chemokine receptor ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. Required for neural tube morphogenesis and neural crest cell migration.
Target Subcellular Location
Nucleus matrix. Cytoplasm, cytoskeleton. Cell projection, ruffle membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, lamellipodium membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, lamellipodium. Note=Colocalizes with the actin cytoskeleton in membrane ruffles and lamellipodia. Detected at the cleavage furrow and contractile ring during cytokinesis. Almost completely in nucleus in cells exposed to heat shock or 10% dimethyl sulfoxide.
Target Protein Families
Actin-binding proteins ADF family
Target Tissue Specificity
Widely distributed in various tissues.
Target Synonyms
18 kDa phosphoprotein; CFL 1; CFL; CFL1; COF1_HUMAN; Cofilin 1; Cofilin 1 non muscle; Cofilin; Cofilin non muscle isoform; Cofilin-1; epididymis secretory protein Li 15; HEL-S-15; non-muscle isoform; p18
Target Background
The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.
Notification