-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CGGBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human CGGBP1 (NP_003654.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CGGBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human CGGBP1 (NP_003654.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03988A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CGGBP1 |
| Target Synonyms | CGGBP; p20-CGGBP; CGGBP1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human CGGBP1 (NP_003654.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC | Uniprot ID | Q9UFW8 |
Uniprot Id
Q9UFW8
Target Species
Human
Target Name
CGGBP1
Target Full Name
CGG triplet repeat-binding protein 1
Target Function
Binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. May play a role in regulating FMR1 promoter.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Ubiquitous. Highly expressed in placenta, thymus, lymph nodes, cerebellum and cerebral cortex. Low expression in other regions of the brain.
Target Synonyms
20 kDa CGG binding protein; 20 kDa CGG-binding protein; CGBP1_HUMAN; CGG binding protein 1; CGG triplet repeat binding protein 1; CGG triplet repeat-binding protein 1; CGG-binding protein 1; CGGBP 1; CGGBP; Cggbp1; OTTHUMP00000213853; OTTHUMP00000213877; p20 CGG binding protein; p20 CGGBP; p20 CGGBP DNA binding protein; p20-CGGBP DNA-binding protein
Target Background
This gene encodes a CGG repeat-binding protein that primarily localizes to the nucleus. CGG trinucleotide repeats are implicated in many disorders as they often act as transcription- and translation-regulatory elements, can produce hairpin structures which cause DNA replication errors, and form regions prone to chromosomal breakage. CGG repeats are also targets for CpG methylation. In addition to its ability to bind CGG repeats and regulate transcription, this gene is believed to play a role in DNA damage repair and telomere protection. In vitro studies indicate this protein does not bind to methylated CpG sequences.
Notification