Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHCHD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human CHCHD1 (NP_976043.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHCHD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human CHCHD1 (NP_976043.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04728A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHCHD1 |
| Target Synonyms | C2360; MRP-S37; C10orf34; CHCHD1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human CHCHD1 (NP_976043.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS | Uniprot ID | Q96BP2 |
Uniprot Id
Q96BP2
Target Species
Human
Target Name
CHCHD1
Target Full Name
Small ribosomal subunit protein mS37
Target Subcellular Location
Mitochondrion. Nucleus.
Target Protein Families
Mitochondrion-specific ribosomal protein mS37 family
Target Synonyms
28S ribosomal protein S37; C10orf34; C2360; CHCH1_HUMAN; CHCHD1; Chromosome 10 open reading frame 34; coiled-coil-helix-coiled-coil-helix domain containing 1; Coiled-coil-helix-coiled-coil-helix domain-containing protein 1; FLJ25854; mitochondrial; MRP-S37; Nuclear protein C2360
Target Background
Enables RNA binding activity. Predicted to be involved in mitochondrial translation. Located in cytosol; mitochondrion; and nuclear lumen.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
