Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHCHD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 75-145 of human CHCHD2 (NP_057223.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CHCHD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 75-145 of human CHCHD2 (NP_057223.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13181A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHCHD2 |
| Target Synonyms | MNRR1; NS2TP; MIX17B; PARK22; C7orf17; D2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, HT-29, Mouse brain, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 75-145 of human CHCHD2 (NP_057223.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCR | Uniprot ID | Q9Y6H1 |
Uniprot Id
Q9Y6H1
Target Species
Human
Target Name
CHCHD2
Target Full Name
Coiled-coil-helix-coiled-coil-helix domain-containing protein 2
Target Function
Transcription factor. Binds to the oxygen responsive element of COX4I2 and activates its transcription under hypoxia conditions (4% oxygen), as well as normoxia conditions (20% oxygen).
Target Involvement
Parkinson disease 22 (PARK22)
Target Subcellular Location
Nucleus. Mitochondrion. Mitochondrion intermembrane space.
Target Synonyms
16.7kD protein; Aging Associated Gene 10 Protein; Aging-associated gene 10 protein; C7orf17; CHCH2_HUMAN; CHCHD 2; CHCHD2; Coiled Coil Helix Coiled Coil Helix Domain Containing 2; Coiled coil helix coiled coil helix domain containing protein 2; mitochondrial; Coiled-coil-helix-coiled-coil-helix domain-containing protein 2; mitochondrial; HCV NS2 trans regulated protein; HCV NS2 trans-regulated protein; NS2TP
Target Background
The protein encoded by this gene belongs to a class of eukaryotic CX(9)C proteins characterized by four cysteine residues spaced ten amino acids apart from one another. These residues form disulfide linkages that define a CHCH fold. In response to stress, the protein translocates from the mitochondrial intermembrane space to the nucleus where it binds to a highly conserved 13 nucleotide oxygen responsive element in the promoter of cytochrome oxidase 4I2, a subunit of the terminal enzyme of the electron transport chain. In concert with recombination signal sequence-binding protein J, binding of this protein activates the oxygen responsive element at four percent oxygen. In addition, it has been shown that this protein is a negative regulator of mitochondria-mediated apoptosis. In response to apoptotic stimuli, mitochondrial levels of this protein decrease, allowing BCL2-associated X protein to oligomerize and activate the caspase cascade. Pseudogenes of this gene are found on multiple chromosomes. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
