Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHD1L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human CHD1L (NP_004275.) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHD1L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human CHD1L (NP_004275.) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13526A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHD1L |
| Target Synonyms | ALC1; CHDL; CHD1L | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human CHD1L (NP_004275.). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLAL | Uniprot ID | Q86WJ1 |
Uniprot Id
Q86WJ1
Target Species
Human
Target Name
CHD1L
Target Full Name
Chromodomain-helicase-DNA-binding protein 1-like
Target Function
DNA helicase which plays a role in chromatin-remodeling following DNA damage. Targeted to sites of DNA damage through interaction with poly(ADP-ribose) and functions to regulate chromatin during DNA repair. Able to catalyze nucleosome sliding in an ATP-dependent manner. Helicase activity is strongly stimulated upon poly(ADP-ribose)-binding.
Target Subcellular Location
Nucleus.
Target Protein Families
SNF2/RAD54 helicase family
Target Tissue Specificity
Frequently overexpressed in hepatomacellular carcinomas.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
ALC1; Amplified in liver cancer 1; Amplified in liver cancer protein 1; chd1l; CHD1L_HUMAN; CHDL; Chromodomain helicase DNA binding protein 1 like; Chromodomain-helicase-DNA-binding protein 1-like; FLJ22530
Target Background
This gene encodes a DNA helicase protein involved in DNA repair. The protein converts ATP to add poly(ADP-ribose) as it regulates chromatin relaxation following DNA damage. Overexpression of this gene has been linked to several types of cancers.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
