Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHML was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CHML (NP_001812.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CHML was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CHML (NP_001812.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07997A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHML |
| Target Synonyms | REP2; CHML | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CHML (NP_001812.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADNLPTEFDVVIIGTGLPESILAAACSRSGQRVLHIDSRSYYGGNWASFSFSGLLSWLKEYQQNNDIGEESTVVWQDLIHETEEAITLRKKDETIQHTE | Uniprot ID | P26374 |
Uniprot Id
P26374
Target Species
Human
Target Name
CHML
Target Full Name
Rab proteins geranylgeranyltransferase component A 2
Target Function
Substrate-binding subunit (component A) of the Rab geranylgeranyltransferase (GGTase) complex. Binds unprenylated Rab proteins and presents the substrate peptide to the catalytic component B. The component A is thought to be regenerated by transferring its prenylated Rab back to the donor membrane. Less effective than CHM in supporting prenylation of Rab3 family.
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
Rab GDI family
Target Synonyms
CHM like; Chml; Choroideraemia like protein; Choroideraemia-like protein; Choroideremia like (Rab escort protein 2); Choroideremia like; Choroideremia like protein; Rab escort protein 2; Rab proteins geranylgeranyltransferase component A 2; RAE2_HUMAN; REP 2; REP-2; REP2
Target Background
The product of the CHML gene supports geranylgeranylation of most Rab proteins and may substitute for REP-1 in tissues other than retina. CHML is localized close to the gene for Usher syndrome type II.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
