-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHMP6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 111-200 of human CHMP6 (NP_078867.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CHMP6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 111-200 of human CHMP6 (NP_078867.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08787A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHMP6 |
| Target Synonyms | VPS20; CHMP6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, PC-3, U2OS | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 111-200 of human CHMP6 (NP_078867.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LNKMHQVMSIEEVERILDETQEAVEYQRQIDELLAGSFTQEDEDAILEELSAITQEQIELPEVPSEPLPEKIPENVPVKARPRQAELVAA | Uniprot ID | Q96FZ7 |
Uniprot Id
Q96FZ7
Target Species
Human
Target Name
CHMP6
Target Full Name
Charged multivesicular body protein 6
Target Function
Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. In the ESCRT-III complex, it probably serves as an acceptor for the ESCRT-II complex on endosomal membranes.
Target Subcellular Location
Endomembrane system. Endosome membrane; Lipid-anchor. Late endosome membrane. Membrane; Lipid-anchor. Note=Localizes to endosomal membranes.
Target Protein Families
SNF7 family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
Charged multivesicular body protein 6; chmp6; CHMP6_HUMAN; Chromatin modifying protein 6; Chromatin-modifying protein 6; FLJ11749; hVps 20; hVps20; novel SNF7 protein; OTTMUSP00000004363; RGD1565325; RP24 225K18.4; Vacuolar protein sorting associated protein 20; Vacuolar protein sorting-associated protein 20; Vps 20; Vps20
Target Background
This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein family. Proteins in this family are part of the ESCRT-III (endosomal sorting complex required for transport III) which degrades surface receptors, and in biosynthesis of endosomes.
Notification