-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHORDC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human CHORDC1 (NP_036256.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHORDC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human CHORDC1 (NP_036256.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06016A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHORDC1 |
| Target Synonyms | CHP1; CHORDC1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human CHORDC1 (NP_036256.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNEENKKEEDNDEIKIGTSCKNG | Uniprot ID | Q9UHD1 |
Uniprot Id
Q9UHD1
Target Species
Human
Target Name
CHORDC1
Target Full Name
Cysteine and histidine-rich domain-containing protein 1
Target Function
Regulates centrosome duplication, probably by inhibiting the kinase activity of ROCK2. Proposed to act as co-chaperone for HSP90. May play a role in the regulation of NOD1 via a HSP90 chaperone complex. In vitro, has intrinsic chaperone activity. This function may be achieved by inhibiting association of ROCK2 with NPM1. Plays a role in ensuring the localization of the tyrosine kinase receptor EGFR to the plasma membrane, and thus ensures the subsequent regulation of EGFR activity and EGF-induced actin cytoskeleton remodeling. Involved in stress response. Prevents tumorigenesis.
Target Tissue Specificity
Underexpressed in many breast and lung cancers.
Target Synonyms
CHORD containing protein 1; Chord domain containing protein 1; CHORD domain-containing protein 1; CHORD-containing protein 1; CHORDC1; CHP-1; CHP1; CHRD1_HUMAN; Cysteine and histidine rich domain (CHORD) containing 1; Cysteine and histidine rich domain (CHORD) containing, zinc binding protein 1; Cysteine and histidine rich domain containing 1; Cysteine and histidine rich domain containing zinc binding protein 1; Cysteine and histidine-rich domain-containing protein 1; FLJ37289; Protein morgana
Target Background
Enables Hsp90 protein binding activity. Predicted to be involved in centrosome duplication; chaperone-mediated protein folding; and regulation of cellular response to heat.
Notification