-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHRDL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 289-458 of human CHRDL1 (NP_001137453.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHRDL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 289-458 of human CHRDL1 (NP_001137453.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05218A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHRDL1 |
| Target Synonyms | CHL; MGC1; MGCN; VOPT; NRLN1; dA141H5.1; CHRDL1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 289-458 of human CHRDL1 (NP_001137453.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CTCNVTKQECKKIHCPNRYPCKYPQKIDGKCCKVCPGKKAKEELPGQSFDNKGYFCGEETMPVYESVFMEDGETTRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIFTEGEAQISQMCSSRVCRTELEDLVKVLYLERSEKGHC | Uniprot ID | Q9BU40 |
Uniprot Id
Q9BU40
Target Species
Human
Target Name
CHRDL1
Target Full Name
Chordin-like protein 1
Target Function
Antagonizes the function of BMP4 by binding to it and preventing its interaction with receptors. Alters the fate commitment of neural stem cells from gliogenesis to neurogenesis. Contributes to neuronal differentiation of neural stem cells in the brain by preventing the adoption of a glial fate. May play a crucial role in dorsoventral axis formation. May play a role in embryonic bone formation. May also play an important role in regulating retinal angiogenesis through modulation of BMP4 actions in endothelial cells. Plays a role during anterior segment eye development.
Target Involvement
Megalocornea 1, X-linked (MGC1)
Target Subcellular Location
Secreted.
Target Tissue Specificity
Expressed in the developing cornea and in the eye anterior segment in addition to the retina. Differentially expressed in the fetal brain. There is high expression in cerebellum and neocortex. Expressed in retinal pericytes.
Target Synonyms
CHL; chordin like 1; Chordin-like protein 1; CHRDL1; CRDL1_HUMAN; dA141H5.1; neuralin 1; Neuralin-1; Neurogenesin-1; NRLN1; Ventroptin; VOPT
Target Background
This gene encodes an antagonist of bone morphogenetic protein 4. The encoded protein may play a role in topographic retinotectal projection and in the regulation of retinal angiogenesis in response to hypoxia. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification