-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHRM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 390-475 of human CHRM3 (NP_000731.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHRM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 390-475 of human CHRM3 (NP_000731.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12355A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHRM3 |
| Target Synonyms | HM3; PBS; EGBRS; CHRM3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 390-475 of human CHRM3 (NP_000731.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQI | Uniprot ID | P20309 |
Uniprot Id
P20309
Target Species
Human
Target Name
CHRM3
Target Full Name
Muscarinic acetylcholine receptor M3
Target Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Target Involvement
Prune belly syndrome (PBS)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily
Target Research Area
Neuroscience
Target Synonyms
AChR; ACM3_HUMAN; cholinergic receptor muscarinic 3; CHRM 3; CHRM3; EGBRS; HM 3; HM3; m3 muscarinic acetylcholine receptor; M3 muscarinic receptor; muscarinic 3; Muscarinic acetylcholine receptor M3; muscarinic cholinergic m3 receptor; muscarinic m3 receptor
Target Background
The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities.
Notification