Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHRM5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 275-370 of human CHRM5 (NP_036257.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHRM5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 275-370 of human CHRM5 (NP_036257.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11205A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHRM5 |
| Target Synonyms | HM5; CHRM5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spinal cord | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 275-370 of human CHRM5 (NP_036257.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHR | Uniprot ID | P08912 |
Uniprot Id
P08912
Target Species
Human
Target Name
CHRM5
Target Full Name
Muscarinic acetylcholine receptor M5
Target Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM5 sub-subfamily
Target Research Area
Neuroscience
Target Synonyms
CHRM5; Muscarinic acetylcholine receptor M5
Target Background
The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The clinical implications of this receptor are unknown; however, stimulation of this receptor is known to increase cyclic AMP levels.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
