Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Chromogranin B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-650 of human Chromogranin B (P05060) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Chromogranin B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-650 of human Chromogranin B (P05060) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14405A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Chromogranin B |
| Target Synonyms | SCG1; Chromogranin B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, BxPC-3, Mouse brain, PC-12, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 550-650 of human Chromogranin B (P05060). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTE | Uniprot ID | P05060 |
Uniprot Id
P05060
Target Species
Human
Target Name
CHGB
Target Full Name
Secretogranin-1
Target Function
Secretogranin-1 is a neuroendocrine secretory granule protein, which may be the precursor for other biologically active peptides.
Target Subcellular Location
Secreted. Note=Neuroendocrine and endocrine secretory granules.
Target Protein Families
Chromogranin/secretogranin protein family
Target Tissue Specificity
Expressed in the adrenal medulla, and in pheochromocytoma. Not expressed in liver.
Target Research Area
Neuroscience
Target Synonyms
CCB peptide; Cg B; CgB; Chgb; Chromogranin-B; ChromograninB; SCG1; SCG1_HUMAN; Secretogranin 1; Secretogranin B; Secretogranin I; SgI
Target Background
This gene encodes a tyrosine-sulfated secretory protein abundant in peptidergic endocrine cells and neurons. This protein may serve as a precursor for regulatory peptides.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
