-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CISD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 61-135 of human CISD2 (NP_001008389.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CISD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 61-135 of human CISD2 (NP_001008389.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05808A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CISD2 |
| Target Synonyms | ERIS; WFS2; ZCD2; NAF-1; Miner1; CISD2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, K-562, Mouse pancreas | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 61-135 of human CISD2 (NP_001008389.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV | Uniprot ID | Q8N5K1 |
Uniprot Id
Q8N5K1
Target Species
Human
Target Name
CISD2
Target Full Name
CDGSH iron-sulfur domain-containing protein 2
Target Function
Regulator of autophagy that contributes to antagonize BECN1-mediated cellular autophagy at the endoplasmic reticulum. Participates in the interaction of BCL2 with BECN1 and is required for BCL2-mediated depression of endoplasmic reticulum Ca(2+) stores during autophagy. Contributes to BIK-initiated autophagy, while it is not involved in BIK-dependent activation of caspases. Involved in life span control, probably via its function as regulator of autophagy.
Target Involvement
Wolfram syndrome 2 (WFS2)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion outer membrane; Single-pass membrane protein. Note=According to PubMed:20010695, it mainly localizes to the endoplasmic reticulum. However, experiments in mouse showed that it mainly localizes to the mitochondrion outer membrane.
Target Protein Families
CISD protein family, CISD2 subfamily
Target Tissue Specificity
Testis, small intestine, kidney, lung, brain, heart, pancreas and platelets.
Target Synonyms
1500009M05Rik; 1500026J14Rik; 1500031D15Rik; AI848398; B630006A20Rik; CDGSH iron sulfur domain 2; CDGSH iron-sulfur domain-containing protein 2; CDGSH type domain 2; CISD2; CISD2_HUMAN; Endoplasmic reticulum intermembrane small protein; ERIS; Miner1; MitoNEET related 1; MitoNEET-related 1 protein; NAF-1; Noxp70; Nutrient deprivation autophagy factor 1; Nutrient-deprivation autophagy factor-1; OTTHUMP00000219576; RGD1566242; WFS2; Zcd2; Zinc finger; Zinc finger; CDGSH type domain 2
Target Background
The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2.
Notification