-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CISH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 17-130 of human CISH (NP_659508.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CISH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 17-130 of human CISH (NP_659508.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05585A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CISH |
| Target Synonyms | CIS; G18; SOCS; CIS-1; BACTS2; CISH | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, K-562, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 17-130 of human CISH (NP_659508.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVR | Uniprot ID | Q9NSE2 |
Uniprot Id
Q9NSE2
Target Species
Human
Target Name
CISH
Target Full Name
Cytokine-inducible SH2-containing protein
Target Function
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. CIS is involved in the negative regulation of cytokines that signal through the JAK-STAT5 pathway such as erythropoietin, prolactin and interleukin 3 (IL3) receptor. Inhibits STAT5 trans-activation by suppressing its tyrosine phosphorylation. May be a substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Target Tissue Specificity
Expressed in various epithelial tissues. Abundantly expressed in liver and kidney, and to a lesser extent in lung. The tissue distribution of isoforms 1 and 1B is distinct.
Target Research Area
Signal Transduction
Target Synonyms
BACTS2; cis 1; CIS; CIS-1; CIS1; Cish; CISH_HUMAN; Cytokine inducible inhibitor of signaling type 1B; Cytokine inducible SH2 containing protein; Cytokine-inducible SH2-containing protein; G18; Protein G18; SOCS; Suppressor of cytokine signaling
Target Background
The protein encoded by this gene contains a SH2 domain and a SOCS box domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family. CIS family members are known to be cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by IL2, IL3, GM-CSF and EPO in hematopoietic cells. Proteasome-mediated degradation of this protein has been shown to be involved in the inactivation of the erythropoietin receptor. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification