Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Citrate synthetase was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 367-466 of human Citrate synthetase (O75390) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Citrate synthetase was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 367-466 of human Citrate synthetase (O75390) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15910A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Citrate synthetase |
| Target Synonyms | CS; Citrate synthetase | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 367-466 of human Citrate synthetase (O75390). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG | Uniprot ID | O75390 |
Uniprot Id
O75390
Target Species
Human
Target Name
CS
Target Full Name
Citrate synthase, mitochondrial
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Citrate synthase family
Target Research Area
Metabolism
Target Synonyms
CISY_HUMAN; Citrate synthase; Citrate synthase; mitochondrial; citrate synthetase; Cs; EC 2.3.3; EC 2.3.3.1
Target Background
The protein encoded by this gene is a Krebs tricarboxylic acid cycle enzyme that catalyzes the synthesis of citrate from oxaloacetate and acetyl coenzyme A. The enzyme is found in nearly all cells capable of oxidative metablism. This protein is nuclear encoded and transported into the mitochondrial matrix, where the mature form is found.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
