-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CKMT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-230 of human CKMT2 (NP_001816.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CKMT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-230 of human CKMT2 (NP_001816.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01790A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CKMT2 |
| Target Synonyms | SMTCK; CKMT2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse diaphragm, Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-230 of human CKMT2 (NP_001816.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDK | Uniprot ID | P17540 |
Uniprot Id
P17540
Target Species
Human
Target Name
CKMT2
Target Full Name
Creatine kinase S-type, mitochondrial
Target Function
Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side.
Target Protein Families
ATP:guanido phosphotransferase family
Target Tissue Specificity
Sarcomere-specific. Found only in heart and skeletal muscles.
Target Synonyms
CKMT 2; Basic-type mitochondrial creatine kinase; CKMT2; CPK; Creatine kinase mitochondrial 2 ; Creatine kinase mitochondrial 2 (sarcomeric); Creatine kinase S-type; creatine kinase S-type, mitochondrial; Creatine kinase, sarcomeric mitochondrial; KCRS_HUMAN; Mib CK; Mib-CK; mitochondrial; OTTHUMP00000147542; S-MtCK; Sarcomeric mitochondrial creatine kinase; SMTCK
Target Background
Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.
Notification