Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CKS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-79 of human CKS2 (NP_001818.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CKS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-79 of human CKS2 (NP_001818.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04065A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CKS2 |
| Target Synonyms | CKSHS2; CKS2 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-79 of human CKS2 (NP_001818.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK | Uniprot ID | P33552 |
Uniprot Id
P33552
Target Species
Human
Target Name
CKS2
Target Full Name
Cyclin-dependent kinases regulatory subunit 2
Target Function
Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.
Target Protein Families
CKS family
Target Research Area
Cell Biology
Target Synonyms
CDC28; CDC28 protein kinase 2; CDC28 protein kinase regulatory subunit 2; CKS 2; CKS-2; CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog 2; Cks2; CKS2_HUMAN; CKSHS2; Cyclin dependent kinases regulatory subunit 2; Cyclin-dependent kinases regulatory subunit 2
Target Background
CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
