Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Clathrin heavy chain was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Clathrin heavy chain (Q00610) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against Clathrin heavy chain was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Clathrin heavy chain (Q00610) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-16609A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Clathrin heavy chain |
| Target Synonyms | Hc; CHC; CHC17; MRD56; CLH-17; CLTCL2; Clathrin heavy chain | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Mouse kidney, NIH/3T3, Jurkat, Rat kidney | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Clathrin heavy chain (Q00610). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG | Uniprot ID | Q00610, P53675 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
