-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Claudin 6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 121-220 of human Claudin 6 (NP_067018.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Claudin 6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 121-220 of human Claudin 6 (NP_067018.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07454A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Claudin 6 |
| Form | Liquid | Species Reactivity | Human, Mouse, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | Rat brain, OVCAR3 |
| Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 121-220 of human Claudin 6 (NP_067018.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV | Uniprot ID | P56747 |
Uniprot Id
P56747
Target Species
Human
Target Name
CLDN6
Target Full Name
Claudin-6
Target Function
Plays a major role in tight junction-specific obliteration of the intercellular space.; (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.
Target Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Target Protein Families
Claudin family
Target Tissue Specificity
Expressed in the liver, in peripheral blood mononuclear cells and hepatocarcinoma cell lines.
Target Synonyms
CLDN6; UNQ757/PRO1488; Claudin-6; Skullin
Target Background
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. This gene encodes a component of tight junction strands, which is a member of the claudin family. The protein is an integral membrane protein and is one of the entry cofactors for hepatitis C virus. The gene methylation may be involved in esophageal tumorigenesis. This gene is adjacent to another family member CLDN9 on chromosome 16.
Notification