Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLCA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-150 of human CLCA1 (NP_001276.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CLCA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-150 of human CLCA1 (NP_001276.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10148A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLCA1 |
| Target Synonyms | CACC; GOB5; CACC1; CLCRG1; CaCC-1; hCLCA1; hCaCC-1; CLCA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse uterus, Rat small intestine | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-150 of human CLCA1 (NP_001276.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NSLIQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQASLYLFEATGKRFYFKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQ | Uniprot ID | A8K7I4 |
Uniprot Id
A8K7I4
Target Species
Human
Target Name
CLCA1
Target Full Name
Calcium-activated chloride channel regulator 1
Target Function
May be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC.
Target Subcellular Location
Secreted, extracellular space. Cell membrane; Peripheral membrane protein; Extracellular side. Note=Protein that remains attached to the plasma membrane appeared to be predominantly localized to microvilli.
Target Protein Families
CLCR family
Target Tissue Specificity
Highly expressed in small intestine and colon namely in intestinal basal crypt epithelia and goblet cells, and appendix. Weakly expressed in uterus, testis and kidney. Expressed in the airways epithelium of both asthmatic and healthy patients. Expressed i
Target Synonyms
CaCC; CaCC-1; CACC1; Calcium dependent chloride channel 1; Calcium-activated chloride channel family member 1; Calcium-activated chloride channel protein 1; Calcium-activated chloride channel regulator 1; Chloride channel calcium activated family member 1; Chloride channel regulator 1; CLCA family member 1 chloride channel regulator; CLCA1; CLCA1_HUMAN; CLCRG1; GOB5; hCaCC-1; hCLCA1
Target Background
This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
