-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLCN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 889-988 of human CLCN1 (NP_000074.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLCN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 889-988 of human CLCN1 (NP_000074.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14611A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLCN1 |
| Target Synonyms | CLC1; CLCN1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 889-988 of human CLCN1 (NP_000074.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NTTSTRKSTGAPPSSAENWNLPEDRPGATGTGDVIAASPETPVPSPSPEPPLSLAPGKVEGELEELELVESPGLEEELADILQGPSLRSTDEEDEDELIL | Uniprot ID | P35523 |
Uniprot Id
P35523
Target Species
Human
Target Name
CLCN1
Target Full Name
Chloride channel protein 1
Target Function
Voltage-gated chloride channel. Plays an important role in membrane repolarization in skeletal muscle cells after muscle contraction. The CLC channel family contains both chloride channels and proton-coupled anion transporters that exchange chloride or another anion for protons. The absence of conserved gating glutamate residues is typical for family members that function as channels.
Target Involvement
Myotonia congenita, autosomal dominant (MCAD); Myotonia congenita, autosomal recessive (MCAR)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Chloride channel (TC 2.A.49) family, ClC-1/CLCN1 subfamily
Target Tissue Specificity
Predominantly expressed in skeletal muscles.
Target Synonyms
Chloride channel protein 1; Chloride channel protein; Chloride channel protein skeletal muscle; CIC 1; CIC1; ClC-1; CLC1; Clcn1; CLCN1_HUMAN; MGC138361; MGC142055; skeletal muscle
Target Background
The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. The protein encoded by this gene regulates the electric excitability of the skeletal muscle membrane. Mutations in this gene cause two forms of inherited human muscle disorders: recessive generalized myotonia congenita (Becker) and dominant myotonia (Thomsen). Alternative splicing results in multiple transcript variants.
Notification