Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLCN3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLCN3 (NP_001230301.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLCN3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLCN3 (NP_001230301.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06738A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLCN3 |
| Target Synonyms | CLC3; ClC-3; NEDSBA; NEDHYBA; CLCN3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLCN3 (NP_001230301.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTHLLDLLDEPIPGVGTYDDFHTIDWVREKCKD | Uniprot ID | P51790 |
Uniprot Id
P51790
Target Species
Human
Target Name
CLCN3
Target Full Name
H(+)/Cl(-) exchange transporter 3
Target Function
Strongly outwardly rectifying, electrogenic H(+)/Cl(-)exchanger which mediates the exchange of chloride ions against protons. The CLC channel family contains both chloride channels and proton-coupled anion transporters that exchange chloride or another anion for protons. The presence of conserved gating glutamate residues is typical for family members that function as antiporters.; Strongly outwardly rectifying, electrogenic H(+)/Cl(-)exchanger which mediates the exchange of chloride ions against protons.
Target Subcellular Location
[Isoform 1]: Early endosome membrane; Multi-pass membrane protein. Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.; [Isoform 2]: Golgi apparatus membrane; Multi-pass membrane protein. Cell projection, ruffle membrane; Multi-pass membrane protein.
Target Protein Families
Chloride channel (TC 2.A.49) family, ClC-3/CLCN3 subfamily
Target Tissue Specificity
Expressed primarily in tissues derived from neuroectoderm. Within the brain, its expression is particularly evident in the hippocampus, olfactory cortex, and olfactory bulb. Highly expressed in aortic and coronary vascular smooth muscle cells, and aortic
Target Synonyms
CLCN3; H(+/Cl(- exchange transporter 3; Chloride channel protein 3; ClC-3; Chloride transporter ClC-3
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
