-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLCN5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 637-816 of human CLCN5 (NP_001121370.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLCN5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 637-816 of human CLCN5 (NP_001121370.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08621A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLCN5 |
| Target Synonyms | XRN; CLC5; XLRH; CLCK2; ClC-5; DENT1; DENTS; NPHL1; NPHL2; hCIC-K2; CLCN5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A673, HepG2, Mouse brain, Mouse ovary, NCI-H460, SW480, U-937 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 637-816 of human CLCN5 (NP_001121370.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YPFLEAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLKHIAQMANQDPDSILFN | Uniprot ID | P51795 |
Uniprot Id
P51795
Target Species
Human
Target Name
CLCN5
Target Full Name
H(+)/Cl(-) exchange transporter 5
Target Function
Proton-coupled chloride transporter. Functions as antiport system and exchanges chloride ions against protons. Important for normal acidification of the endosome lumen. May play an important role in renal tubular function.
Target Involvement
Hypophosphatemic rickets, X-linked recessive (XLRHR); Nephrolithiasis 2 (NPHL2); Nephrolithiasis 1 (NPHL1); Low molecular weight proteinuria with hypercalciuria and nephrocalcinosis (LMWPHN)
Target Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Target Protein Families
Chloride channel (TC 2.A.49) family, ClC-5/CLCN5 subfamily
Target Tissue Specificity
Kidney. Moderately expressed in aortic vascular smooth muscle and endothelial cells, and at a slightly higher level in the coronary vascular smooth muscle.
Target Synonyms
Chloride Channel 5; Chloride channel protein 5; Chloride channel voltage sensitive 5; Chloride transporter ClC-5; ClC-5; CLC5; CLCK2; CLCN5; CLCN5_HUMAN; DENTS; H(+)/Cl(-) exchange transporter 5; hCIC-K2; NPHL1; NPHL2; Voltage gated chloride ion channel CLCN5; XLRH; XRN
Target Background
This gene encodes a member of the ClC family of chloride ion channels and ion transporters. The encoded protein is primarily localized to endosomal membranes and may function to facilitate albumin uptake by the renal proximal tubule. Mutations in this gene have been found in Dent disease and renal tubular disorders complicated by nephrolithiasis. Alternatively spliced transcript variants have been found for this gene.
Notification