Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLDN5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 119-218 of human CLDN5 (NP_001349995.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CLDN5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 119-218 of human CLDN5 (NP_001349995.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Western blot analysis of various lysates, using CLDN5 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
| Cat.No | ADA-13039A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLDN5 |
| Target Synonyms | AWAL; BEC1; TMVCF; TMDVCF; CPETRL1; CLDN5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 119-218 of human CLDN5 (NP_001349995.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV | Uniprot ID | O00501 |
Uniprot Id
O00501
Target Species
Human
Target Name
CLDN5
Target Full Name
Claudin-5
Target Function
Plays a major role in tight junction-specific obliteration of the intercellular space.
Target Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Target Protein Families
Claudin family
Target Synonyms
CLDN5; AWAL; TMVCF; Claudin-5; Transmembrane protein deleted in VCFS; TMDVCF
Target Background
This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
