-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLDN7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-211 of human CLDN7 (NP_001298.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CLDN7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-211 of human CLDN7 (NP_001298.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12247A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLDN7 |
| Target Synonyms | CLDN-7; CEPTRL2; CPETRL2; Hs.84359; claudin-1; CLDN7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse large intestine | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-211 of human CLDN7 (NP_001298.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV | Uniprot ID | O95471 |
Uniprot Id
O95471
Target Species
Human
Target Name
CLDN7
Target Full Name
Claudin-7
Target Function
Plays a major role in tight junction-specific obliteration of the intercellular space.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane. Cell junction, tight junction.
Target Protein Families
Claudin family
Target Tissue Specificity
Expressed in kidney, lung and prostate. Isoform 1 seems to be predominant, except in some normal prostate samples, where isoform 2 is the major form. Down-regulated in breast cancers, including ductal carcinoma in situ (DCIS), lobular carcinoma in situ (L
Target Synonyms
CLDN7; CEPTRL2; CPETRL2; Claudin-7; CLDN-7
Target Background
This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found.
Notification