-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human CLK1 (NP_004062.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human CLK1 (NP_004062.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02809A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLK1 |
| Target Synonyms | CLK; STY; CLK/STY; CLK1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human CLK1 (NP_004062.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESRSINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIHHSTSHRRSHG | Uniprot ID | P49759 |
Uniprot Id
P49759
Target Species
Human
Target Name
CLK1
Target Full Name
Dual specificity protein kinase CLK1
Target Function
Dual specificity kinase acting on both serine/threonine and tyrosine-containing substrates. Phosphorylates serine- and arginine-rich (SR) proteins of the spliceosomal complex and may be a constituent of a network of regulatory mechanisms that enable SR proteins to control RNA splicing. Phosphorylates: SRSF1, SRSF3 and PTPN1. Regulates the alternative splicing of tissue factor (F3) pre-mRNA in endothelial cells and adenovirus E1A pre-mRNA.
Target Subcellular Location
Nucleus.
Target Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, Lammer subfamily
Target Tissue Specificity
Endothelial cells.
Target Synonyms
CDC like kinase 1; CDC-like kinase 1; CDC28/CDC2 like kinase; CLK; CLK/STY; Clk1; CLK1_HUMAN; Dual specificity protein kinase CLK1; Protein tyrosine kinase STY; STY
Target Background
This gene encodes a member of the CDC2-like (or LAMMER) family of dual specificity protein kinases. In the nucleus, the encoded protein phosphorylates serine/arginine-rich proteins involved in pre-mRNA processing, releasing them into the nucleoplasm. The choice of splice sites during pre-mRNA processing may be regulated by the concentration of transacting factors, including serine/arginine rich proteins. Therefore, the encoded protein may play an indirect role in governing splice site selection. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification