Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLN6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 121-190 of human CLN6 (NP_060352.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLN6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 121-190 of human CLN6 (NP_060352.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02732A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLN6 |
| Target Synonyms | nclf; CLN4A; CLN6A; HsT18960; CLN6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 121-190 of human CLN6 (NP_060352.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYLGHCMWYIPFFLILF | Uniprot ID | Q9NWW5 |
Uniprot Id
Q9NWW5
Target Species
Human
Target Name
CLN6
Target Full Name
Ceroid-lipofuscinosis neuronal protein 6
Target Involvement
Ceroid lipofuscinosis, neuronal, 6 (CLN6); Ceroid lipofuscinosis, neuronal, 4A (CLN4A)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum.
Target Synonyms
CLN6; Ceroid-lipofuscinosis neuronal protein 6; Protein CLN6
Target Background
This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
