-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Clusterin alpha chain was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 314-449 of human Clusterin alpha chain (NP_001822.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Clusterin alpha chain was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 314-449 of human Clusterin alpha chain (NP_001822.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09560A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Clusterin alpha chain |
| Target Synonyms | CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2; Clusterin alpha chain | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human plasma, Mouse plasma, Rat plasma | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 314-449 of human Clusterin alpha chain (NP_001822.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE | Uniprot ID | P10909 |
Uniprot Id
P10909
Target Species
Human
Target Name
CLU
Target Full Name
Clusterin
Target Function
Functions as extracellular chaperone that prevents aggregation of non native proteins. Prevents stress-induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Protects cells against apoptosis and against cytolysis by complement. Intracellular forms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. A mitochondrial form suppresses BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation. An intracellular form suppresses stress-induced apoptosis by stabilizing mitochondrial membrane integrity through interaction with HSPA5. Secreted form does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity. Secreted form act as an important modulator during neuronal differentiation through interaction with STMN3. Plays a role in the clearance of immune complexes that arise during cell injury.; Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity.; Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity. Promotes cell death through interaction with BCL2L1 that releases and activates BAX.
Target Subcellular Location
[Isoform 1]: Secreted.; [Isoform 4]: Cytoplasm.; [Isoform 6]: Cytoplasm.; Nucleus. Cytoplasm. Mitochondrion membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytosol. Microsome. Endoplasmic reticulum. Mitochondrion. Mitochondrion membrane. Cytoplasm, perinuclear region. Cytoplasmic vesicle, secretory vesicle, chromaffin granule.
Target Protein Families
Clusterin family
Target Tissue Specificity
Detected in blood plasma, cerebrospinal fluid, milk, seminal plasma and colon mucosa. Detected in the germinal center of colon lymphoid nodules and in colon parasympathetic ganglia of the Auerbach plexus (at protein level). Ubiquitous. Detected in brain,
Target Research Area
Immunology, Apoptosis
Target Synonyms
40; AAG 4; AAG4; Aging associated protein 4; Aging-associated gene 4 protein; AI893575; APO J; Apo-J; APOJ; ApoJalpha; ApoJbeta; Apolipoprotein J; ApolipoproteinJ; CLI; CLU; CLU1; CLU2; CLUS_HUMAN; Clusterin alpha chain; Clusterin; Clusterin beta chain; Complement associated protein SP 40 40; Complement associated protein SP 40; Complement associated protein SP40; Complement cytolysis inhibitor a chain; Complement cytolysis inhibitor; Complement cytolysis inhibitor b chain; Complement lysis inhibitor; Complement-associated protein SP-40; D14Ucla3; Dimeric acid glycoprotein; Glycoprotein 80; Glycoprotein III; GP80; Ku70-binding protein 1; KUB 1; KUB1; MGC24903; NA1/NA2; RATTRPM2B; SGP 2; SGP2; SP 40; SP40; Sugp-2; Sulfated glycoprotein 2; Testosterone repressed prostate message 2; Testosterone-repressed prostate message 2; TRPM 2; TRPM-2; TRPM2; TRPM2B; Trpmb
Target Background
The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.
Notification