Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CMIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 640-773 of human CMIP (NP_938204.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CMIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 640-773 of human CMIP (NP_938204.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03809A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CMIP |
| Target Synonyms | TCMIP; CMIP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, K-562, Mouse testis, Rat kidney | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 640-773 of human CMIP (NP_938204.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RLTLPSKSTDADLARLLSSGSFGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLWSTQFGDAGLRLLSEHLTMLQVLNLCETPVTDAGLLALSSMKSLCSLNMNSTKLSADTYEDLKAKLPNLKEVDVRYTEAW | Uniprot ID | Q8IY22 |
Uniprot Id
Q8IY22
Target Species
Human
Target Name
CMIP
Target Full Name
C-Maf-inducing protein
Target Function
Plays a role in T-cell signaling pathway. Isoform 2 may play a role in T-helper 2 (Th2) signaling pathway and seems to represent the first proximal signaling protein that links T-cell receptor-mediated signal to the activation of c-Maf Th2 specific factor.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Tissue Specificity
Isoform 1 is expressed in peripheral blood mononuclear cells and kidney. Lower expression in brain and liver. Expression is down-regulated in activated cells. Isoform 2 is expressed in lymphocyte precursors, however, expression shuts down during maturatio
Target Synonyms
TCMIP; CMIP
Target Background
This gene encodes a c-Maf inducing protein that plays a role in T-cell signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
