-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CMKLR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human CMKLR1 (NP_001135815.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CMKLR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human CMKLR1 (NP_001135815.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05664A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CMKLR1 |
| Target Synonyms | DEZ; ERV1; RVER1; ChemR23; CHEMERINR; CMKLR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, LO2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CMKLR1 (NP_001135815.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NRLAKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSLGLPLATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSH | Uniprot ID | Q99788 |
Uniprot Id
Q99788
Target Species
Human
Target Name
CMKLR1
Target Full Name
Chemerin-like receptor 1
Target Function
Receptor for the chemoattractant adipokine chemerin/RARRES2 and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with RARRES2 initiates activation of G proteins G(i)/G(o) and beta-arrestin pathways inducing cellular responses via second messenger pathways such as intracellular calcium mobilization, phosphorylation of MAP kinases MAPK1/MAPK3 (ERK1/2), TYRO3, MAPK14/P38MAPK and PI3K leading to multifunctional effects, like, reduction of immune responses, enhancing of adipogenesis and angionesis PubMed:27716822. Resolvin E1 down-regulates cytokine production in macrophages by reducing the activation of MAPK1/3 (ERK1/2) and NF-kappa-B. Positively regulates adipogenesis and adipocyte metabolism.; (Microbial infection) Acts as a coreceptor for several SIV strains (SIVMAC316, SIVMAC239, SIVMACL7E-FR and SIVSM62A), as well as a primary HIV-1 strain (92UG024-2).
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Prominently expressed in developing osseous and cartilaginous tissue. Also found in adult parathyroid glands. Expressed in cardiovascular system, brain, kidney, gastrointestinal tissues and myeloid tissues. Expressed in a broad array of tissues associated
Target Research Area
Cell Biology
Target Synonyms
CMKLR1; CHEMR23; DEZ; Chemerin-like receptor 1; Chemokine-like receptor 1; G-protein coupled receptor ChemR23; G-protein coupled receptor DEZ
Target Background
Enables adipokinetic hormone binding activity and adipokinetic hormone receptor activity. Involved in several processes, including negative regulation of NF-kappaB transcription factor activity; positive regulation of macrophage chemotaxis; and regulation of calcium-mediated signaling. Located in plasma membrane.
Notification