Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CMTM3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CMTM3 (NP_653202.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against CMTM3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CMTM3 (NP_653202.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of paraffin-embedded human colon using CMTM3 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Cat.No | ADA-04468A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CMTM3 |
| Target Synonyms | BNAS2; CKLFSF3; CMTM3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CMTM3 (NP_653202.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MWPPDPDPDPDPEPAGGSRPGPAVPGLRALLPARAFLCSLKGRLLLAESGLSFITFICYVASSASAFLTAPLLEFLLALYFLFADAMQLNDKWQGLCWPM | Uniprot ID | Q96MX0 |
Uniprot Id
Q96MX0
Target Species
Human
Target Name
CMTM3
Target Full Name
CKLF-like MARVEL transmembrane domain-containing protein 3
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Chemokine-like factor family
Target Tissue Specificity
Expressed in the leukocytes, placenta and testis.
Target Synonyms
CMTM3; CKLFSF3; CKLF-like MARVEL transmembrane domain-containing protein 3; Chemokine-like factor superfamily member 3
Target Background
This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants containing different 5' UTRs, but encoding the same protein, have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
