Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CNOT7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-160 of human CNOT7 (NP_037486.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CNOT7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-160 of human CNOT7 (NP_037486.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01077A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CNOT7 |
| Target Synonyms | CAF1; CAF-1; Caf1a; hCAF-1; CNOT7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 22Rv1, HT-29, Mouse brain, Mouse lung, Raji, Rat lung, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-160 of human CNOT7 (NP_037486.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGY | Uniprot ID | Q9UIV1 |
Uniprot Id
Q9UIV1
Target Species
Human
Target Name
CNOT7
Target Full Name
CCR4-NOT transcription complex subunit 7
Target Function
Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT8. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.
Target Subcellular Location
Nucleus. Cytoplasm, P-body.
Target Protein Families
CAF1 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
BTG1 binding factor 1; BTG1-binding factor 1; CAF 1; CAF-1; CAF1; Carbon catabolite repressor protein (CCR4) associative factor 1; CCR4 associated factor 1; CCR4 NOT transcription complex subunit 7; CCR4-associated factor 1; CCR4-NOT transcription complex subunit 7; CNOT 7; Cnot7; CNOT7_HUMAN; hCAF 1; hCAF1
Target Background
The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The encoded protein downregulates the innate immune response and therefore provides a therapeutic target for enhancing its antimicrobial activity against foreign agents. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and X.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
