Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 835-935 of human COG1 (NP_061184.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against COG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 835-935 of human COG1 (NP_061184.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06982A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COG1 |
| Target Synonyms | LDLB; CDG2G; COG1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 835-935 of human COG1 (NP_061184.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSRIEKVTDHLEALIDPFDLDVFTPHLNSNLHRLVQRTSVLFGLVTGTENQLAPRSSTFNSQEPHNILPLASSQIRFGLLPLSMTSTRKAKSTRNIETKAQ | Uniprot ID | Q8WTW3 |
Uniprot Id
Q8WTW3
Target Species
Human
Target Name
COG1
Target Full Name
Conserved oligomeric Golgi complex subunit 1
Target Function
Required for normal Golgi function.
Target Involvement
Congenital disorder of glycosylation 2G (CDG2G)
Target Subcellular Location
Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
COG1 family
Target Synonyms
COG1; KIAA1381; LDLBConserved oligomeric Golgi complex subunit 1; COG complex subunit 1; Component of oligomeric Golgi complex 1
Target Background
The protein encoded by this gene is one of eight proteins (Cog1-8) which form a Golgi-localized complex (COG) required for normal Golgi morphology and function. It is thought that this protein is required for steps in the normal medial and trans Golgi-associated processing of glycoconjugates and plays a role in the organization of the Golgi-localized complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
