Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COG4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 310-410 of human COG4 (NP_056201.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COG4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 310-410 of human COG4 (NP_056201.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04634A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COG4 |
| Target Synonyms | COD1; CDG2J; SWILS; COG4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain, Mouse liver, Mouse lung, Rat pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 310-410 of human COG4 (NP_056201.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQVECDRQVEKVVDKFIKQRDYHQQFRHVQNNLMRNSTTEKIEPRELDPILTEVTLMNARSELYLRFLKKRISSDFEVGDSMASEEVKQEHQKCLDKLLNN | Uniprot ID | Q9H9E3 |
Uniprot Id
Q9H9E3
Target Species
Human
Target Name
COG4
Target Full Name
Conserved oligomeric Golgi complex subunit 4
Target Function
Required for normal Golgi function. Plays a role in SNARE-pin assembly and Golgi-to-ER retrograde transport via its interaction with SCFD1.
Target Involvement
Congenital disorder of glycosylation 2J (CDG2J)
Target Subcellular Location
Cytoplasm, cytosol. Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
COG4 family
Target Synonyms
COG4Conserved oligomeric Golgi complex subunit 4; COG complex subunit 4; Component of oligomeric Golgi complex 4
Target Background
The protein encoded by this gene is a component of an oligomeric protein complex involved in the structure and function of the Golgi apparatus. Defects in this gene may be a cause of congenital disorder of glycosylation type IIj. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
