-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COL11A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-380 of human COL11A2 (NP_542411.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COL11A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-380 of human COL11A2 (NP_542411.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01554A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COL11A2 |
| Target Synonyms | HKE5; PARP; STL3; FBCG2; DFNA13; DFNB53; OSMEDA; OSMEDB; COL11A2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A375, HepG2, K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 210-380 of human COL11A2 (NP_542411.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IVPGVQAAYESCEQKELECEGGQRERPQNQQPHRAQRSPQQQPSRLHRPQNQEPQSQPTESLYYDYEPPYYDVMTTGTTPDYQDPTPGEEEEILESSLLPPLEEEQTDLQVPPTADRFQAEEYGEGGTDPPEGPYDYTYGYGDDYREETELGPALSAETAHSGAAAHGPRG | Uniprot ID | P13942 |
Uniprot Id
P13942
Target Species
Human
Target Name
COL11A2
Target Full Name
Collagen alpha-2(XI) chain
Target Function
May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils.
Target Involvement
Otospondylomegaepiphyseal dysplasia, autosomal dominant (OSMEDA); Otospondylomegaepiphyseal dysplasia, autosomal recessive (OSMEDB); Deafness, autosomal dominant, 13 (DFNA13); Deafness, autosomal recessive, 53 (DFNB53); Fibrochondrogenesis 2 (FBCG2)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Fibrillar collagen family
Target Synonyms
COBA2_HUMAN; COL11A2; Collagen alpha 2(XI); Collagen alpha-2(XI) chain; Collagen type XI alpha 2; Collagen XI a2; DAQB-79P13.8; DFNA13; DFNB53; FBCG2; HGNC:2187; HKE5; PARP; Pro a2 chain of collagen type XI; STL3
Target Background
This gene encodes one of the two alpha chains of type XI collagen, a minor fibrillar collagen. It is located on chromosome 6 very close to but separate from the gene for retinoid X receptor beta. Type XI collagen is a heterotrimer but the third alpha chain is a post-translationally modified alpha 1 type II chain. Proteolytic processing of this type XI chain produces PARP, a proline/arginine-rich protein that is an amino terminal domain. Mutations in this gene are associated with type III Stickler syndrome, otospondylomegaepiphyseal dysplasia (OSMED syndrome), Weissenbacher-Zweymuller syndrome, autosomal dominant non-syndromic sensorineural type 13 deafness (DFNA13), and autosomal recessive non-syndromic sensorineural type 53 deafness (DFNB53). Alternative splicing results in multiple transcript variants. A related pseudogene is located nearby on chromosome 6.
Notification