-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COL18A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1050-1150 of human COL18A1 (NP_085059.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COL18A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1050-1150 of human COL18A1 (NP_085059.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04528A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COL18A1 |
| Target Synonyms | KS; KNO; GLCC; KNO1; COL18A1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1050-1150 of human COL18A1 (NP_085059.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGLPGNQGPPGPKGAKGEVGPPGPPGQFPFDFLQLEAEMKGEKGDRGDAGQKGERGEPGGGGFFGSSLPGPPGPPGPRGYPGIPGPKGESIRGQPGPPGPQ | Uniprot ID | P39060 |
Uniprot Id
P39060
Target Species
Human
Target Name
COL18A1
Target Full Name
Collagen alpha-1(XVIII) chain
Target Function
Probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.; May regulate extracellular matrix-dependent motility and morphogenesis of endothelial and non-endothelial cells; the function requires homotrimerization and implicates MAPK signaling.; Potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling. Inhibits VEGFA-induced endothelial cell proliferation and migration. Seems to inhibit VEGFA-mediated signaling by blocking the interaction of VEGFA to its receptor KDR/VEGFR2. Modulates endothelial cell migration in an integrin-dependent manner implicating integrin ITGA5:ITGB1 and to a lesser extent ITGAV:ITGB3 and ITGAV:ITGB5. May negatively regulate the activity of homotrimeric non-collagenous domain 1.
Target Involvement
Knobloch syndrome 1 (KNO1)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, extracellular matrix, basement membrane.; [Non-collagenous domain 1]: Secreted, extracellular space, extracellular matrix, basement membrane. Secreted.; [Endostatin]: Secreted. Secreted, extracellular space, extracellular matrix, basement membrane.
Target Protein Families
Multiplexin collagen family
Target Tissue Specificity
Present in multiple organs with highest levels in liver, lung and kidney.
Target Research Area
Cell Adhesion
Target Synonyms
Alpha 1 collagen type 18 (XVIII)(COL18A1); Alpha 1 type XVIII collagen; Antiangiogenic agent; COIA1_HUMAN; COL15A1; Col18a1; Collagen alpha 1(XV) chain; Collagen alpha 1(XVIII) chain; Collagen alpha-1(XV) chain; Collagen type XV proteoglycan; Collagen type XVIII alpha 1; Collagen XV; alpha 1 polypeptide; Collagen; type XV; alpha 1; Endostatin; Endostatin XV; FLJ27325; FLJ34914; FLJ38566; KNO; KNO1; KS; MGC74745; Multi functional protein MFP; OTTHUMP00000021782; OTTHUMP00000115472; OTTHUMP00000115473
Target Background
This gene encodes the alpha chain of type XVIII collagen. This collagen is one of the multiplexins, extracellular matrix proteins that contain multiple triple-helix domains (collagenous domains) interrupted by non-collagenous domains. A long isoform of the protein has an N-terminal domain that is homologous to the extracellular part of frizzled receptors. Proteolytic processing at several endogenous cleavage sites in the C-terminal domain results in production of endostatin, a potent antiangiogenic protein that is able to inhibit angiogenesis and tumor growth. Mutations in this gene are associated with Knobloch syndrome. The main features of this syndrome involve retinal abnormalities, so type XVIII collagen may play an important role in retinal structure and in neural tube closure. Alternative splicing results in multiple transcript variants.
Notification