Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COL9A2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-689 of human COL9A2 (NP_001843.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COL9A2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-689 of human COL9A2 (NP_001843.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06883A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COL9A2 |
| Target Synonyms | MED; EDM2; STL5; DJ39G22.4; COL9A2 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600-689 of human COL9A2 (NP_001843.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RGEKGDPGEVGRGHPGMPGPPGIPGLPGRPGQAINGKDGDRGSPGAPGEAGRPGLPGPVGLPGFCEPAACLGASAYASARLTEPGSIKGP | Uniprot ID | Q14055 |
Uniprot Id
Q14055
Target Species
Human
Target Name
COL9A2
Target Full Name
Collagen alpha-2(IX) chain
Target Function
Structural component of hyaline cartilage and vitreous of the eye.
Target Involvement
Multiple epiphyseal dysplasia 2 (EDM2); Intervertebral disc disease (IDD); Stickler syndrome 5 (STL5)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Fibril-associated collagens with interrupted helices (FACIT) family
Target Synonyms
CO9A2_HUMAN; COL9A2; Collagen alpha-2(IX) chain
Target Background
This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. This chain is unusual in that, unlike the other two type IX alpha chains, it contains a covalently attached glycosaminoglycan side chain. Mutations in this gene are associated with multiple epiphyseal dysplasia.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
