-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Collagen I/COL1A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1151-1250 of human Collagen I/COL1A1 (NP_000079.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Collagen I/COL1A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1151-1250 of human Collagen I/COL1A1 (NP_000079.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13145A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Collagen I/COL1A1 |
| Target Synonyms | OI1; OI2; OI3; OI4; EDSC; CAFYD; EDSARTH1; Collagen I/COL1A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse bone | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1151-1250 of human Collagen I/COL1A1 (NP_000079.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEG | Uniprot ID | P02452 |
Uniprot Id
P02452
Target Species
Human
Target Name
COL1A1
Target Full Name
Collagen alpha-1(I) chain
Target Function
Type I collagen is a member of group I collagen (fibrillar forming collagen).
Target Involvement
Caffey disease (CAFFD); Ehlers-Danlos syndrome, classic type (EDS); Ehlers-Danlos syndrome 7A (EDS7A); Osteogenesis imperfecta 1 (OI1); Osteogenesis imperfecta 2 (OI2); Osteogenesis imperfecta 3 (OI3); Osteogenesis imperfecta 4 (OI4); Osteoporosis (OSTEOP)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Fibrillar collagen family
Target Tissue Specificity
Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.
Target Research Area
Signal Transduction
Target Synonyms
Alpha-1 type I collagen
Target Background
This gene encodes the pro-alpha1 chains of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIA, Ehlers-Danlos syndrome Classical type, Caffey Disease and idiopathic osteoporosis. Reciprocal translocations between chromosomes 17 and 22, where this gene and the gene for platelet-derived growth factor beta are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans, resulting from unregulated expression of the growth factor. Two transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.
Notification