-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COMP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-160 of human COMP (NP_000086.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against COMP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-160 of human COMP (NP_000086.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12366A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COMP |
| Target Synonyms | MED; CTS2; EDM1; EPD1; TSP5; PSACH; THBS5; TSP-5; COMP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60, LO2, Mouse skeletal muscle, Rat testis, SKOV3, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-160 of human COMP (NP_000086.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSG | Uniprot ID | P49747 |
Uniprot Id
P49747
Target Species
Human
Target Name
COMP
Target Full Name
Cartilage oligomeric matrix protein
Target Function
May play a role in the structural integrity of cartilage via its interaction with other extracellular matrix proteins such as the collagens and fibronectin. Can mediate the interaction of chondrocytes with the cartilage extracellular matrix through interaction with cell surface integrin receptors. Could play a role in the pathogenesis of osteoarthritis. Potent suppressor of apoptosis in both primary chondrocytes and transformed cells. Suppresses apoptosis by blocking the activation of caspase-3 and by inducing the IAP family of survival proteins (BIRC3, BIRC2, BIRC5 and XIAP). Essential for maintaining a vascular smooth muscle cells (VSMCs) contractile/differentiated phenotype under physiological and pathological stimuli. Maintains this phenotype of VSMCs by interacting with ITGA7.
Target Involvement
Multiple epiphyseal dysplasia 1 (EDM1); Pseudoachondroplasia (PSACH)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Thrombospondin family
Target Tissue Specificity
Abundantly expressed in the chondrocyte extracellular matrix, and is also found in bone, tendon, ligament and synovium and blood vessels. Increased amounts are produced during late stages of osteoarthritis in the area adjacent to the main defect.
Target Synonyms
cartilage oligomeric matrix protein (pseudoachondroplasia; epiphyseal dysplasia 1; multiple); Cartilage oligomeric matrix protein; Cartilage oligomeric matrix protein precursor; COMP; COMP_HUMAN; EDM 1; EDM1; EPD 1; EPD1; Epiphyseal dysplasia 1; Epiphyseal dysplasia 1 multiple; Epiphyseal dysplasia multiple 1; MED; MGC13181; MGC149768; PSACH; pseudoachondroplasia (epiphyseal dysplasia 1; multiple); Pseudoachondroplasia; THBS 5; THBS5; Thrombospondin 5; Thrombospondin-5; Thrombospondin5; TSP5
Target Background
The protein encoded by this gene is a noncollagenous extracellular matrix (ECM) protein. It consists of five identical glycoprotein subunits, each with EGF-like and calcium-binding (thrombospondin-like) domains. Oligomerization results from formation of a five-stranded coiled coil and disulfides. Binding to other ECM proteins such as collagen appears to depend on divalent cations. Contraction or expansion of a 5 aa aspartate repeat and other mutations can cause pseudochondroplasia (PSACH) and multiple epiphyseal dysplasia (MED).
Notification